PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_931_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 362aa    MW: 39416.9 Da    PI: 7.2919
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_931_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181461148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  cra_locus_931_iso_1_len_1577_ver_3 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                                        79********************************************97 PP

2Myb_DNA-binding537.9e-1767112148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                         rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  cra_locus_931_iso_1_len_1577_ver_3  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.747961IPR017930Myb domain
SuperFamilySSF466891.27E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.02E-111661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.2E-1667112IPR001005SANT/Myb domain
CDDcd001671.22E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010091Biological Processtrichome branching
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPKN DALLSTADGQ SKDAANLSHM AQWESARLEA EARLVRQSKL RSNNNTSSFQ  180
NTLQEFSNSP SSPLSKSPVV VPPRCLDILK AWNGVWTNPN ESSTASAVAA VSVAGGLVGD  240
VESPTSTLSS NGIGDHNSTA FFEFVGNNSL RPSSEIHDLT VPMDHVGDNV IAGSTFVERF  300
TDLLLSTSGD RSFSEGCGES DNGGVTAGSG GGSTSEYLED NKNYWNSILN LVNSSPSDSA  360
MF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016493290.11e-178PREDICTED: transcription factor MYB35-like
TrEMBLA0A068U3S81e-179A0A068U3S8_COFCA; Uncharacterized protein
STRINGSolyc02g088190.2.11e-171(Solanum lycopersicum)